Products

IL-34 (Interleukin-34), Human

Interleukin-34 (IL-34) is a protein that promotes the proliferation, survival and differentiation of monocytes and macrophages. It also promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. IL-34 plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1.
No. Size Price Qty Status
C01040-5UG 5 ug $108.00 Inquiry
C01040-20UG 20 ug $268.00 Inquiry
C01040-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEG
HPSWKYLQEVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPS
LQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP with polyhistidine tag at the C-terminus

UnitProt ID:
Q6ZMJ4
 
Source:

Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce human peripheral blood monocytes (PBMCs) proliferation. The ED50 for this effect is <30 pg/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for IL-34 (Interleukin-34), Human

Average Rating: 0 (0 Reviews )